Structure of PDB 8gje Chain K |
>8gjeK (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] |
DIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKL ERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL |
|
PDB | 8gje Glycan heterogeneity as a cause of the persistent fraction in HIV-1 neutralization |
Chain | K |
Resolution | 3.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MAN |
K |
W67 G68 |
W63 G64 |
|
|
|