Structure of PDB 8ez5 Chain K

Receptor sequence
>8ez5K (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB8ez5 Structural evidence for intermediates during O 2 formation in photosystem II.
ChainK
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide K D23 V24 L35 W39 V43 R46 D14 V15 L26 W30 V34 R37
BS02 CLA K P29 L33 P20 L24
BS03 CLA K F32 W39 Q40 F23 W30 Q31
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ez5, PDBe:8ez5, PDBj:8ez5
PDBsum8ez5
PubMed37138085
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]