Structure of PDB 8ev3 Chain K

Receptor sequence

>8ev3K (length=249) Species: 4896 (Schizosaccharomyces pombe)

ELLGSDAPLEKVCSALLEYESKRKSLLEDEQDDIEPVWLQLATLKFIGNN
RKLIPYKIAIKNPVIPSSSEACLIVKDPQRVYKDLVNEAGLSKVVTRVIG
LSKLKAKWNSYEQKRQLRDQFDIFLADDRVIPMLPRILGKTFYQKSKVPV
PVKISKGTAEQLKREVVSAYGATYFNSAPCSSFMIKCGHVSNTSTELAEN
VESILQFVSKHIVPDGAKGIASIHLKTSQSIAIPLWNNPNLKELIASSR

3D structure

• PDB: 8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: K
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	W54 Q56 A58 N65 N66 R67 K68 L69 K92 D93 L117 S118 N125 S126 Y127 E128 R131 D144 R145 I147 P148 M149 P151 R152 G155 K156 K161 S162 A194 P195 C196 S197 S198 M200 H227 S238 H240 K242 Q245 S246 I247 A248	W38 Q40 A42 N49 N50 R51 K52 L53 K76 D77 L101 S102 N109 S110 Y111 E112 R115 D128 R129 I131 P132 M133 P135 R136 G139 K140 K145 S146 A178 P179 C180 S181 S182 M184 H211 S222 H224 K226 Q229 S230 I231 A232

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
• PDBsum: 8ev3
• PubMed: 36423630
• UniProt: Q9UT32|RL1DB_SCHPO Putative ribosome biogenesis protein C8F11.04 (Gene Name=SPAC8F11.04)