Structure of PDB 8eti Chain K

Receptor sequence

>8etiK (length=240) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

ELLGSDAPLEKVCSALLEYESKRKSPVWLQLATLKFIGNNRKLIPYKIAI
KNPVIPSSSEACLIVKDPQRVYKDLVNEAGLSKVVTRVIGLSKLKAKWNS
YEQKRQLRDQFDIFLADDRVIPMLPRILGKTFYQKSKVPVPVKISKGTAE
QLKREVVSAYGATYFNSAPCSSFMIKCGHVSNTSTELAENVESILQFVSK
HIVPDGAKGIASIHLKTSQSIAIPLWNNPNLKELIASSRK

3D structure

PDB

8eti Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	Q56 L57 A58 N66 R67 K68 L69 D93 S118 S126 Y127 E128 D144 R145 V146 P148 M149 P151 R152 G155 K156 S162 C196 S197 S198 Q245 S246 I247 A248	Q30 L31 A32 N40 R41 K42 L43 D67 S92 S100 Y101 E102 D118 R119 V120 P122 M123 P125 R126 G129 K130 S136 C170 S171 S172 Q219 S220 I221 A222

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0003723	RNA binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8eti, PDBe:8eti, PDBj:8eti
PDBsum	8eti
PubMed	36423630
UniProt	Q9UT32\|RL1DB_SCHPO Putative ribosome biogenesis protein C8F11.04 (Gene Name=SPAC8F11.04)

[Back to BioLiP]