Structure of PDB 8ebu Chain K

Receptor sequence
>8ebuK (length=172) Species: 9606 (Homo sapiens) [Search protein sequence]
YVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLK
DCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALE
EAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEEN
LEDDMYRKTCTMCGHELTYEKM
3D structure
PDB8ebu Lesion recognition by XPC, TFIIH and XPA in DNA excision repair.
ChainK
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K K151 Q174 W175 R207 K50 Q73 W74 R106
BS02 dna K T140 K141 T142 H171 W175 G176 M178 K179 M214 K217 K218 T39 K40 T41 H70 W74 G75 M77 K78 M113 K116 K117
BS03 ZN K C105 C108 C129 C4 C7 C28
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000715 nucleotide-excision repair, DNA damage recognition
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006289 nucleotide-excision repair
GO:0009650 UV protection
GO:0010996 response to auditory stimulus
GO:0034504 protein localization to nucleus
GO:0070914 UV-damage excision repair
GO:1901255 nucleotide-excision repair involved in interstrand cross-link repair
Cellular Component
GO:0000110 nucleotide-excision repair factor 1 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005662 DNA replication factor A complex
GO:0045171 intercellular bridge

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ebu, PDBe:8ebu, PDBj:8ebu
PDBsum8ebu
PubMed37076618
UniProtP23025|XPA_HUMAN DNA repair protein complementing XP-A cells (Gene Name=XPA)

[Back to BioLiP]