Structure of PDB 8dga Chain K

Receptor sequence
>8dgaK (length=182) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFT
AMGAGRSKKEAKHAAARALIDKLITQHSNKVSQFHKTLKNATGKKLLKLQ
KTCLKNNKIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLP
VGVCHGSGPTAADAQRHAAQNALEYLKIMTKK
3D structure
PDB8dga Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
ChainK
Resolution3.73 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K K134 T135 H163 K190 K3 T4 H32 K59
BS02 rna K F167 K189 F36 K58
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0005515 protein binding
GO:0035197 siRNA binding
GO:1905172 RISC complex binding
Biological Process
GO:0007417 central nervous system development
GO:0009047 dosage compensation by hyperactivation of X chromosome
GO:0010468 regulation of gene expression
GO:0010586 miRNA metabolic process
GO:0030422 siRNA processing
GO:0030718 germ-line stem cell population maintenance
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0048132 female germ-line stem cell asymmetric division
GO:0070920 regulation of regulatory ncRNA processing
GO:0070922 RISC complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016442 RISC complex
GO:0070578 RISC-loading complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dga, PDBe:8dga, PDBj:8dga
PDBsum8dga
PubMed36182693
UniProtQ9VJY9|LOQS_DROME Protein Loquacious (Gene Name=loqs)

[Back to BioLiP]