Structure of PDB 8dg7 Chain K

Receptor sequence

>8dg7K (length=181) Species: 7227 (Drosophila melanogaster)

AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTFTA
MGAGRSKKEAKHAAARALIDKLITQHSNKVSQFHKTLKNATGKKLLKLQK
TCLKNNKIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLPV
GVCHGSGPTAADAQRHAAQNALEYLKIMTKK

3D structure

• PDB: 8dg7 Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
• Chain: K
• Resolution: 3.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	T135 S138 I162	T4 S7 I31
BS02	rna	K	F167 R187 S188 K189 K190	F36 R55 S56 K57 K58

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003725 double-stranded RNA binding
• GO:0005515 protein binding
• GO:0035197 siRNA binding
• GO:1905172 RISC complex binding

Biological Process

• GO:0007417 central nervous system development
• GO:0009047 dosage compensation by hyperactivation of X chromosome
• GO:0010468 regulation of gene expression
• GO:0010586 miRNA metabolic process
• GO:0030422 siRNA processing
• GO:0030718 germ-line stem cell population maintenance
• GO:0031047 regulatory ncRNA-mediated gene silencing
• GO:0031054 pre-miRNA processing
• GO:0048132 female germ-line stem cell asymmetric division
• GO:0070920 regulation of regulatory ncRNA processing
• GO:0070922 RISC complex assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016442 RISC complex
• GO:0070578 RISC-loading complex

External links

• PDB: RCSB:8dg7, PDBe:8dg7, PDBj:8dg7
• PDBsum: 8dg7
• PubMed: 36182693
• UniProt: Q9VJY9|LOQS_DROME Protein Loquacious (Gene Name=loqs)