Structure of PDB 8d8k Chain K

Receptor sequence
>8d8kK (length=141) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KEEVVKYILHGKFTKNNTHLTFSSVVEDKNTYNDTMLYYLNLPQKVKISL
STGCLGFRKAARGEYEAAFQTSGRMFELIKEKNMLNKDIEVVMDDFGKGR
AAFISALVGKEGASVVKKVVKISDATKLKFGGVRSPKMRRL
3D structure
PDB8d8k Principles of mitoribosomal small subunit assembly in eukaryotes.
ChainK
Resolution3.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K H79 K81 K84 N85 N86 H88 N117 Q120 V122 G129 C130 K135 A136 R138 K203 L204 K205 F206 G207 V209 R210 K213 R215 R216 L217 H10 K12 K15 N16 N17 H19 N41 Q44 V46 G53 C54 K59 A60 R62 K127 L128 K129 F130 G131 V133 R134 K137 R139 R140 L141
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d8k, PDBe:8d8k, PDBj:8d8k
PDBsum8d8k
PubMed36482135
UniProtP42847|RT18_YEAST Small ribosomal subunit protein uS11m (Gene Name=MRPS18)

[Back to BioLiP]