Structure of PDB 8csu Chain K

Receptor sequence
>8csuK (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
HYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAA
LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRAT
3D structure
PDB8csu Principles of mitoribosomal small subunit assembly in eukaryotes.
ChainK
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K V30 D31 W32 R33 R51 R80 C83 V85 R102 V3 D4 W5 R6 R24 R53 C56 V58 R75
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0031965 nuclear membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8csu, PDBe:8csu, PDBj:8csu
PDBsum8csu
PubMed36482135
UniProtO60783|RT14_HUMAN Small ribosomal subunit protein uS14m (Gene Name=MRPS14)

[Back to BioLiP]