Structure of PDB 8cgu Chain K

Receptor sequence

>8cguK (length=111) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]

GVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAE
RCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPH
DGCRPPKKRRV

3D structure

PDB

8cgu Structural conservation of antibiotic interaction with ribosomes.

Chain

Resolution

1.89 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	H22 N28 N29 I31 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 P115 I116 P117 H118 X119 G120 C121 R122 P124 K125 R127 R128	H4 N10 N11 I13 T15 G21 N22 A23 W26 T28 G30 G31 R35 G36 S37 K39 K69 P97 I98 P99 H100 X101 G102 C103 R104 P106 K107 R109 R110

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cgu, PDBe:8cgu, PDBj:8cgu
PDBsum	8cgu
PubMed	37550453
UniProt	P0A7R9\|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)