Structure of PDB 8b64 Chain K

Receptor sequence
>8b64K (length=43) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence]
LSFTGLTDEQAQELHAVYMSGLSAFIAVAVLAHLAVMIWRPWF
3D structure
PDB8b64 Cryo-EM structure of a monomeric RC-LH1-PufX supercomplex with high-carotenoid content from Rhodobacter capsulatus.
ChainK
Resolution2.589 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL K A35 H39 V42 W48 F49 A29 H33 V36 W42 F43
BS02 SPO K F31 V34 A41 W45 F25 V28 A35 W39
BS03 BCL K F31 V34 A38 H39 F25 V28 A32 H33
BS04 SPO K E19 L20 V23 Y24 G27 L28 F31 E13 L14 V17 Y18 G21 L22 F25
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b64, PDBe:8b64, PDBj:8b64
PDBsum8b64
PubMed36738736
UniProtP02950|LHB1_RHOCA Light-harvesting protein B-870 beta chain (Gene Name=pufB)

[Back to BioLiP]