Structure of PDB 8b0x Chain K

Receptor sequence
>8b0xK (length=117) Species: 37762 (Escherichia coli B) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHDGCRPPKKRRV
3D structure
PDB8b0x The translating bacterial ribosome at 1.55 angstrom resolution generated by cryo-EM imaging services.
ChainK
Resolution1.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K H22 N28 N29 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 I116 H118 X119 G121 C122 R123 K126 R128 R129 H10 N16 N17 T21 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 K75 I104 H106 X107 G108 C109 R110 K113 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b0x, PDBe:8b0x, PDBj:8b0x
PDBsum8b0x
PubMed36841832
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]