Structure of PDB 7zqc Chain K

Receptor sequence
>7zqcK (length=86) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
GFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVI
SNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL
3D structure
PDB7zqc Algal photosystem I dimer and high-resolution model of PSI-plastocyanin complex.
ChainK
Resolution2.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K V87 L90 V60 L63
BS02 CLA K N60 T61 N33 T34
BS03 CLA K R50 F51 S78 N79 D80 P81 F84 R23 F24 S51 N52 D53 P54 F57
BS04 CLA K G102 G106 G75 G79
BS05 CLA K F29 N35 M38 T42 H97 F2 N8 M11 T15 H70
BS06 CLA K A44 A48 L53 A54 P55 L65 A17 A21 L26 A27 P28 L38
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zqc, PDBe:7zqc, PDBj:7zqc
PDBsum7zqc
PubMed36229605
UniProtP14225|PSAK_CHLRE Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]