Structure of PDB 7zq9 Chain K

Receptor sequence
>7zq9K (length=86) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
GFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVI
SNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL
3D structure
PDB7zq9 Algal photosystem I dimer and high-resolution model of PSI-plastocyanin complex.
ChainK
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K I86 V87 I59 V60
BS02 CLA K T61 L65 T34 L38
BS03 CLA K A63 L65 A36 L38
BS04 CLA K R50 F51 S78 N79 D80 P81 F84 R23 F24 S51 N52 D53 P54 F57
BS05 CLA K G102 G106 G75 G79
BS06 CLA K N35 M38 V39 T42 H97 N8 M11 V12 T15 H70
BS07 CLA K A44 A48 L53 A54 P55 L65 L67 A17 A21 L26 A27 P28 L38 L40
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zq9, PDBe:7zq9, PDBj:7zq9
PDBsum7zq9
PubMed36229605
UniProtP14225|PSAK_CHLRE Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]