Structure of PDB 7zdi Chain K

Receptor sequence
>7zdiK (length=49) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence]
MNQGRIWTVVNPGVGLPLLLGSVTVIAILVHYAVLSNTTWFPKYWNGAT
3D structure
PDB7zdi Cryo-EM structures of light-harvesting 2 complexes from Rhodopseudomonas palustris reveal the molecular origin of absorption tuning.
ChainK
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 IRM K L20 V23 L20 V23
BS02 IRM K H31 Y32 H31 Y32
BS03 BCL K Y44 W45 Y44 W45
BS04 BCL K T24 H31 W40 F41 W45 T24 H31 W40 F41 W45
BS05 IRM K Q3 I6 Q3 I6
BS06 BCL K I26 A27 V30 H31 I26 A27 V30 H31
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7zdi, PDBe:7zdi, PDBj:7zdi
PDBsum7zdi
PubMed36251992
UniProtP35102|LHA2_RHOPA Light-harvesting protein B-800-850 alpha chain B (Gene Name=pucAB)

[Back to BioLiP]