Structure of PDB 7z31 Chain K

Receptor sequence

>7z31K (length=101) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGY
SIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKS
M

3D structure

PDB

7z31 Structural basis of Ty1 integrase tethering to RNA polymerase III for targeted retrotransposon integration.

Chain

Resolution

2.76 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	K	T136 I139 K140	T95 I98 K99

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0005515	protein binding
GO:0046983	protein dimerization activity

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006361	transcription initiation at RNA polymerase I promoter
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription
GO:0006383	transcription by RNA polymerase III
GO:0006384	transcription initiation at RNA polymerase III promoter
GO:0006386	termination of RNA polymerase III transcription
GO:0042254	ribosome biogenesis
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005666	RNA polymerase III complex
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:7z31, PDBe:7z31, PDBj:7z31
PDBsum	7z31
PubMed	36977686
UniProt	P28000\|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 (Gene Name=RPC19)