Structure of PDB 7z30 Chain K |
>7z30K (length=101) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
PDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGY SIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKS M |
|
PDB | 7z30 Structural basis of Ty1 integrase tethering to RNA polymerase III for targeted retrotransposon integration. |
Chain | K |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
K |
T136 I139 M142 |
T95 I98 M101 |
|
|
|
|