Structure of PDB 7yca Chain K

Receptor sequence
>7ycaK (length=87) Species: 70448 (Ostreococcus tauri) [Search protein sequence]
WSIGSTENMIVCFNTTAILGAMRFGLMPSVKKNFNGASSHTAMVEQANAK
TIGSRDPSGFTAVDVLAGGSLATIISAGEILAGQVPY
3D structure
PDB7yca The photosystem I supercomplex from a primordial green alga Ostreococcus tauri harbors three light-harvesting complex trimers.
ChainK
Resolution2.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K L125 Q128 V129 P130 L81 Q84 V85 P86
BS02 CLA K V107 A111 V63 A67
BS03 CLA K F78 N79 F34 N35
BS04 CLA K R67 F68 S98 R99 D100 P101 F104 V109 R23 F24 S54 R55 D56 P57 F60 V65
BS05 CLA K I118 G122 A126 V129 I74 G78 A82 V85
BS06 CLA K W45 N52 V55 T59 W1 N8 V11 T15
BS07 CLA K L70 M71 P72 T85 M87 L26 M27 P28 T41 M43
BS08 CHL K T50 I54 T6 I10
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yca, PDBe:7yca, PDBj:7yca
PDBsum7yca
PubMed36951548
UniProtA0A096P8E8

[Back to BioLiP]