Structure of PDB 7y7b Chain K

Receptor sequence
>7y7bK (length=78) Species: 173977 (Chroomonas placoidea) [Search protein sequence]
VPQTAAWSAKTCSVMVISNLLCIVAGRYVIQVKGSGPSLPLTGSFSNFGL
PELLATTSLGHIVGSGAILGLSYVGLLS
3D structure
PDB7y7b Structural basis and evolution of the photosystem I-light-harvesting supercomplex of cryptophyte algae.
ChainK
Resolution2.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLA K P11 L78 P2 L69
BS02 CLA K L59 L63 L50 L54
BS03 CLA K L30 V38 Q40 L21 V29 Q31
BS04 CLA K V72 G75 A76 G79 Y82 V63 G66 A67 G70 Y73
BS05 CLA K W16 C21 M24 N28 L29 I32 H70 W7 C12 M15 N19 L20 I23 H61
BS06 8CT K P49 T66 H70 I71 P40 T57 H61 I62
BS07 IHT K A64 S67 L68 A55 S58 L59
BS08 CLA K L30 V33 L21 V24
BS09 CLA K S22 I26 L85 S13 I17 L76
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7y7b, PDBe:7y7b, PDBj:7y7b
PDBsum7y7b
PubMed36943796
UniProtA0A222AI34

[Back to BioLiP]