Structure of PDB 7wfg Chain K

Receptor sequence
>7wfgK (length=167) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SIKFPILDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFASLR
SSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFS
TDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKIAREIYKDRI
RRCFTTNHKFFVVRSPH
3D structure
PDB7wfg Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
ChainK
Resolution4.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 K C43 C44 T80 G106 A107 C108 G138 C139 P140 C41 C42 T64 G90 A91 C92 G122 C123 P124
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0019684 photosynthesis, light reaction
GO:1902600 proton transmembrane transport
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wfg, PDBe:7wfg, PDBj:7wfg
PDBsum7wfg
PubMed35123031
UniProtP56756|NDHK_ARATH NAD(P)H-quinone oxidoreductase subunit K, chloroplastic (Gene Name=ndhK)

[Back to BioLiP]