Structure of PDB 7w5y Chain K

Receptor sequence
>7w5yK (length=107) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTL
GDYIRQRRLLLAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRRQFDRTP
SDYRHRL
3D structure
PDB7w5y Structural basis of three different transcription activation strategies adopted by a single regulator SoxS.
ChainK
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K W36 Q39 R43 I73 P100 S101 W36 Q39 R43 I73 P100 S101
BS02 dna K H3 Y33 S34 W36 Y37 Y82 V83 Q86 T87 H3 Y33 S34 W36 Y37 Y82 V83 Q86 T87
Gene Ontology
Molecular Function
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001108 bacterial-type RNA polymerase holo enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w5y, PDBe:7w5y, PDBj:7w5y
PDBsum7w5y
PubMed36243985
UniProtP0A9E2|SOXS_ECOLI Regulatory protein SoxS (Gene Name=soxS)

[Back to BioLiP]