Structure of PDB 7w5x Chain K

Receptor sequence
>7w5xK (length=107) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTL
GDYIRQRRLLLAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRRQFDRTP
SDYRHRL
3D structure
PDB7w5x Structural basis of three different transcription activation strategies adopted by a single regulator SoxS.
ChainK
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K Y33 S34 W36 Y37 R55 G81 Y82 V83 T87 R94 Y33 S34 W36 Y37 R55 G81 Y82 V83 T87 R94
BS02 dna K I24 W36 Q39 R40 R43 T49 I73 Q85 Q86 S89 R90 P100 S101 I24 W36 Q39 R40 R43 T49 I73 Q85 Q86 S89 R90 P100 S101
Gene Ontology
Molecular Function
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001108 bacterial-type RNA polymerase holo enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w5x, PDBe:7w5x, PDBj:7w5x
PDBsum7w5x
PubMed36243985
UniProtP0A9E2|SOXS_ECOLI Regulatory protein SoxS (Gene Name=soxS)

[Back to BioLiP]