Structure of PDB 7v2m Chain K

Receptor sequence
>7v2mK (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB7v2m Decoding the Mechanism of Specific RNA Targeting by Ribosomal Methyltransferases.
ChainK
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K R12 Y20 H22 N26 N27 T31 G37 N38 P39 W42 S44 G46 V47 K51 G52 S53 K55 R85 H116 N117 C119 R120 K122 R126 R2 Y10 H12 N16 N17 T21 G27 N28 P29 W32 S34 G36 V37 K41 G42 S43 K45 R75 H106 N107 C109 R110 K112 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v2m, PDBe:7v2m, PDBj:7v2m
PDBsum7v2m
PubMed35316014
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]