Structure of PDB 7uw1 Chain K

Receptor sequence

>7uw1K (length=144) Species: 480119 (Acinetobacter baumannii AB0057)

TLRLNELAPAEGAKREHRRLGRGIGSGVGKTGGRGIKGQKSRKSGGVRPG
FEGGQTAIYRRLPKFGFTSQIALKTAEVRLSELSKVEGDIVSLETLKAAN
VVRRDQIRARIVLSGEITRAFTVQGVALTKGAKAAIEAAGGKVE

3D structure

• PDB: 7uw1 Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
• Chain: K
• Resolution: 2.21 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	L5 N6 L8 E12 G13 A14 K15 R16 R19 R20 L21 G22 R23 G24 G26 G30 K31 T32 G34 R35 G36 K38 G39 Q40 K41 R43 K44 S45 F52 E53 G54 G55 Q56 T57 Y60 R61 R62 L63 P64 K65 F66 G67 F68 S70 E78 R80 E83 N101 R104 R105 R109 R111 V113 L114 S115 T130 K131 G132	L4 N5 L7 E11 G12 A13 K14 R15 R18 R19 L20 G21 R22 G23 G25 G29 K30 T31 G33 R34 G35 K37 G38 Q39 K40 R42 K43 S44 F51 E52 G53 G54 Q55 T56 Y59 R60 R61 L62 P63 K64 F65 G66 F67 S69 E77 R79 E82 N100 R103 R104 R108 R110 V112 L113 S114 T129 K130 G131

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uw1, PDBe:7uw1, PDBj:7uw1
• PDBsum: 7uw1
• PubMed: 37192172
• UniProt: B7IA20|RL15_ACIB5 Large ribosomal subunit protein uL15 (Gene Name=rplO)