Structure of PDB 7rjb Chain K

Receptor sequence

>7rjbK (length=383) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

MPTRKSNTYLSLVNSYLIDSPQPSSINYWWNLGSLLGLCLVIQIASGVFL
AMHYSSNIELAFDSVEHIMRDVNAGWLIRYIHANGASFFFICMYLHIGKA
LYYGSYKQPRVMLWVIGVVIFILTMAIAFMGYCLVYGQMSHWGATVITNL
LSAIPFIGNDIVPFIWGGFSVSNPTIQRFFALHFLLPFILAALVCMHLMA
LHVHGSSNPVGITGNIDRLPMHPYFIFKDLITVFVFLLIFSLFVFYSPNT
LGHPDNYIPGNPMVTPPSIVPEWYLLPFYAILRSIPDKLGGVIAMFGAIL
ILLSLPYTDRSIIRGNSFKVLSKLAFYLFVFNFILLGNLGQLHVEVPYIQ
LGQFATAYYFAHYIIVVPVISTLENILYYIGTQ

3D structure

PDB

7rjb Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	K	Q43 I44 G47 V48 Y54 V65 R79 H82 A86 F89 I127 G131 L134 V135 H183 F184 P187	Q43 I44 G47 V48 Y54 V65 R79 H82 A86 F89 I127 G131 L134 V135 H183 F184 P187
BS02	HEM	K	W30 G33 L36 G37 F89 M93 H96 I97 K99 S105 L113 G117 V118 I120 V194 H197 L201 S206 S207	W30 G33 L36 G37 F89 M93 H96 I97 K99 S105 L113 G117 V118 I120 V194 H197 L201 S206 S207
BS03	U10	K	M125 A126 F129 G143 V146 I147 P271 L275 Y279 M295 F296	M125 A126 F129 G143 V146 I147 P271 L275 Y279 M295 F296
BS04	U10	K	Y16 Q22 L198 L201 M221	Y16 Q22 L198 L201 M221

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0000792	heterochromatin
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7rjb, PDBe:7rjb, PDBj:7rjb
PDBsum	7rjb
PubMed	34525326
UniProt	P0C8L0\|CYB_CANAL Cytochrome b (Gene Name=COB)

[Back to BioLiP]