Structure of PDB 7r3k Chain K

Receptor sequence

>7r3kK (length=84) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

FIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVIS
NDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGA

3D structure

PDB

7r3k Structure of Photosystem I Supercomplex Isolated from a Chlamydomonas reinhardtii Cytochrome b6f Temperature-Sensitive Mutant.

Chain

Resolution

2.52 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	K	I86 V87 L90 A91	I58 V59 L62 A63
BS02	CLA	K	P55 N60 T61 L65	P27 N32 T33 L37
BS03	CLA	K	A63 L65	A35 L37
BS04	CLA	K	F29 N35 M38 V39 H97	F1 N7 M10 V11 H69
BS05	CLA	K	G102 I103 G106 G109 I110	G74 I75 G78 G81 I82
BS06	CLA	K	A44 A48 L53 A54 P55 L65	A16 A20 L25 A26 P27 L37
BS07	CLA	K	L46 R50 S78 N79 D80 P81 F84	L18 R22 S50 N51 D52 P53 F56

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

External links

PDB	RCSB:7r3k, PDBe:7r3k, PDBj:7r3k
PDBsum	7r3k
PubMed	36979472
UniProt	P14225\|PSAK_CHLRE Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)