Structure of PDB 7qiz Chain K

Receptor sequence

>7qizK (length=184) Species: 4081 (Solanum lycopersicum) [Search protein sequence]

MKTILSSETMDIPDGITIKVKAKQIEVEGPRGKLTRNFKHLNLDFQLIKK
KLKIDAWFGSRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPINA
SISGGNKSIEIRNFLGEKKVRKVDMLDGVTVVRSEKVKDELVLDGNDIEL
VSRSAALINQKCHVKNKDIRKFLDGIYVSEKGRI

3D structure

PDB

7qiz Specific features and methylation sites of a plant ribosome

Chain

Resolution

2.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	M1 A22 K23 H40 N42 L43 D44 A62 W63 R67 A71 R74 T75 S78 H79 N82 H101 F102 E123 K124 K125 S158 R159 Q166 K171 K173 D174 R176 K177 F178	M1 A22 K23 H40 N42 L43 D44 A56 W57 R61 A65 R68 T69 S72 H73 N76 H95 F96 E117 K118 K119 S152 R153 Q160 K165 K167 D168 R170 K171 F172

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qiz, PDBe:7qiz, PDBj:7qiz
PDBsum	7qiz
PubMed	35643637
UniProt	A0A3Q7JDZ0

[Back to BioLiP]