Structure of PDB 7q4n Chain K

Receptor sequence
>7q4nK (length=66) Species: 9606 (Homo sapiens) [Search protein sequence]
DKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQN
RRAKERKINKKKLQQQ
3D structure
PDB7q4n transcription factor CDX2 bound to hydroxymethylated DNA
ChainK
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K Y189 R190 V191 V192 Y193 R198 R228 Q229 N236 K240 Y3 R4 V5 V6 Y7 R12 R42 Q43 N50 K54
BS02 dna K Y189 R190 V192 Y210 I213 K216 Q235 R238 R242 Y3 R4 V6 Y24 I27 K30 Q49 R52 R56
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7q4n, PDBe:7q4n, PDBj:7q4n
PDBsum7q4n
PubMed
UniProtQ99626|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]