Structure of PDB 7po0 Chain K

Receptor sequence
>7po0K (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]
HYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAA
LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRAT
W
3D structure
PDB7po0 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainK
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K H28 Y29 D31 W32 R33 W35 R36 R40 R51 N55 R58 I75 R80 C83 V85 R86 R88 N89 R90 T94 R96 P97 R98 G99 K101 R102 R108 I109 R112 T127 W128 H1 Y2 D4 W5 R6 W8 R9 R13 R24 N28 R31 I48 R53 C56 V58 R59 R61 N62 R63 T67 R69 P70 R71 G72 K74 R75 R81 I82 R85 T100 W101
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0031965 nuclear membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7po0, PDBe:7po0, PDBj:7po0
PDBsum7po0
PubMed35676484
UniProtO60783|RT14_HUMAN Small ribosomal subunit protein uS14m (Gene Name=MRPS14)

[Back to BioLiP]