Structure of PDB 7pic Chain K

Receptor sequence

>7picK (length=136) Species: 272634 (Mycoplasmoides pneumoniae M129)

ATIAQLIRKPRKKKKVKSKSPALHYNLNLLNKKVTNVYSPLKRGVCTRVG
TMTPKKPNSALRKYAKVRLTNGFEVLTYIPGEGHNLQEHSVTLLRGGRVK
DLPGVRYHIVRGTLDTVGVEKRRQQRSAYGAKKPKA

3D structure

• PDB: 7pic Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: K
• Resolution: 9.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	A2 T3 A5 Q6 R9 R12 K13 K14 K15 V17 K18 K20 H25 N29 L30 L31 Y39 S40 P41 L42 K43 R44 R49 K57 N59 S60 A61 L62 R63 K64 G82 E83 R96 G97 G98 R99 V100 K101 D102 G105 R107 K122 R123 R124 Q125 Q126 R127 S128 K133 K134	A1 T2 A4 Q5 R8 R11 K12 K13 K14 V16 K17 K19 H24 N28 L29 L30 Y38 S39 P40 L41 K42 R43 R48 K56 N58 S59 A60 L61 R62 K63 G81 E82 R95 G96 G97 R98 V99 K100 D101 G104 R106 K121 R122 R123 Q124 Q125 R126 S127 K132 K133

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pic, PDBe:7pic, PDBj:7pic
• PDBsum: 7pic
• PubMed: 36171285
• UniProt: P75546|RS12_MYCPN Small ribosomal subunit protein uS12 (Gene Name=rpsL)