Structure of PDB 7pib Chain K

Receptor sequence

>7pibK (length=136) Species: 272634 (Mycoplasmoides pneumoniae M129)

ATIAQLIRKPRKKKKVKSKSPALHYNLNLLNKKVTNVYSPLKRGVCTRVG
TMTPKKPNSALRKYAKVRLTNGFEVLTYIPGEGHNLQEHSVTLLRGGRVK
DLPGVRYHIVRGTLDTVGVEKRRQQRSAYGAKKPKA

3D structure

• PDB: 7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: K
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	A5 Q6 L7 R9 R12 K13 K15 K18 S19 K20 H25 N29 S40 P41 L42 K43 R44 K57 N59 S60 L62 R63 K64 T71 G82 G84 R96 G97 R99 V100 K101 P104 G105 R107 G113 R123 R124 Q125 Q126 R127 S128 Y130 A132 K133	A4 Q5 L6 R8 R11 K12 K14 K17 S18 K19 H24 N28 S39 P40 L41 K42 R43 K56 N58 S59 L61 R62 K63 T70 G81 G83 R95 G96 R98 V99 K100 P103 G104 R106 G112 R122 R123 Q124 Q125 R126 S127 Y129 A131 K132

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pib, PDBe:7pib, PDBj:7pib
• PDBsum: 7pib
• PubMed: 36171285
• UniProt: P75546|RS12_MYCPN Small ribosomal subunit protein uS12 (Gene Name=rpsL)