Structure of PDB 7o1v Chain K

Receptor sequence
>7o1vK (length=80) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
LAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLAS
KKTFGLPELLATMSFGHILGAGMVLGLASS
3D structure
PDB7o1v Two-Dimensional Electronic Spectroscopy of a Minimal Photosystem I Complex Reveals the Rate of Primary Charge Separation.
ChainK
Resolution4.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K Q10 A11 Q3 A4
BS02 CLA K L67 A68 L60 A61
BS03 CLA K G79 M80 G83 S87 G72 M73 G76 S80
BS04 CLA K V22 M26 N30 H74 V15 M19 N23 H67
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o1v, PDBe:7o1v, PDBj:7o1v
PDBsum7o1v
PubMed34472838
UniProtP74564|PSAK2_SYNY3 Photosystem I reaction center subunit PsaK 2 (Gene Name=psaK2)

[Back to BioLiP]