Structure of PDB 7m78 Chain K

Receptor sequence
>7m78K (length=47) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ILCNLFAIALGRYAIQSRGKGPGLGLPELLATTSFGHLLAAGVVSGL
3D structure
PDB7m78 Room temperature XFEL crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem I.
ChainK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K L21 F25 H67 L2 F6 H37
BS02 CLA K L68 L69 G72 S75 L38 L39 G42 S45
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m78, PDBe:7m78, PDBj:7m78
PDBsum7m78
PubMed34750381
UniProtP0A425|PSAK_THEVB Photosystem I reaction center subunit PsaK (Gene Name=psaK)

[Back to BioLiP]