Structure of PDB 7m4y Chain K

Receptor sequence

>7m4yK (length=144) Species: 480119 (Acinetobacter baumannii AB0057)

TLRLNELAPAEGAKREHRRLGRGIGSGVGKTGGRGIKGQKSRKSGGVRPG
FEGGQTAIYRRLPKFGFTSQIALKTAEVRLSELSKVEGDIVSLETLKAAN
VVRRDQIRARIVLSGEITRAFTVQGVALTKGAKAAIEAAGGKVE

3D structure

• PDB: 7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
• Chain: K
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	N6 E12 G13 A14 K15 R16 H18 R19 R20 L21 G22 R23 G24 G26 G30 K31 T32 G34 R35 G36 K38 G39 Q40 K41 R43 K44 S45 F52 E53 G54 G55 Q56 T57 Y60 R61 R62 P64 K65 F66 G67 F68 S70 R80 E83 K86 N101 R104 R105 R109 R111 V113 L114 S115 T130 G132	N5 E11 G12 A13 K14 R15 H17 R18 R19 L20 G21 R22 G23 G25 G29 K30 T31 G33 R34 G35 K37 G38 Q39 K40 R42 K43 S44 F51 E52 G53 G54 Q55 T56 Y59 R60 R61 P63 K64 F65 G66 F67 S69 R79 E82 K85 N100 R103 R104 R108 R110 V112 L113 S114 T129 G131
BS02	MG	K	K44 S45	K43 S44

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
• PDBsum: 7m4y
• PubMed: 34044590
• UniProt: B7IA20|RL15_ACIB5 Large ribosomal subunit protein uL15 (Gene Name=rplO)