Structure of PDB 7k55 Chain K

Receptor sequence

>7k55K (length=100) Species: 83333 (Escherichia coli K-12)

MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP
INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS

3D structure

• PDB: 7k55 Structural basis for +1 ribosomal frameshifting during EF-G-catalyzed translocation.
• Chain: K
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	R2 Y49 K53 R86 V89 M90 R91	R2 Y49 K53 R86 V89 M90 R91

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7k55, PDBe:7k55, PDBj:7k55
• PDBsum: 7k55
• PubMed: 34330903
• UniProt: P02358|RS6_ECOLI Small ribosomal subunit protein bS6 (Gene Name=rpsF)