Structure of PDB 7jil Chain K

Receptor sequence
>7jilK (length=121) Species: 986 (Flavobacterium johnsoniae) [Search protein sequence]
MVQQESRLKVADNTGAKEVLTIRVLGGTKRRYASVGDKIVVSIKDATPNG
NVKKGAVSTAVVVRTKKEVRRADGSYIRFDDNACVLLNAAGEMRGTRVFG
PVARELREKQFMKIVSLAPEV
3D structure
PDB7jil Structural basis of sequestration of the anti-Shine-Dalgarno sequence in the Bacteroidetes ribosome.
ChainK
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K M1 Q3 Q4 E5 S6 R7 I22 R23 T28 R30 R31 Y32 K66 K67 Y76 M1 Q3 Q4 E5 S6 R7 I22 R23 T28 R30 R31 Y32 K66 K67 Y76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jil, PDBe:7jil, PDBj:7jil
PDBsum7jil
PubMed33330920
UniProtA5FMZ0|RL14_FLAJ1 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]