Structure of PDB 7f9o Chain K

Receptor sequence
>7f9oK (length=84) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]
YIGSSTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGLQTGD
PAGFTLADTLACGAVGHIMGVGIVLGLKNTGVLD
3D structure
PDB7f9o Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.
ChainK
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K K78 A79 K32 A33
BS02 CLA K L64 G95 D96 F100 T105 L18 G49 D50 F54 T59
BS03 CLA K G118 K124 G72 K78
BS04 CLA K I48 N53 M56 H113 I2 N7 M10 H67
BS05 CLA K L71 P73 K84 L25 P27 K38
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f9o, PDBe:7f9o, PDBj:7f9o
PDBsum7f9o
PubMed34879391
UniProtP36886|PSAK_HORVU Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]