Structure of PDB 7dz8 Chain K

Receptor sequence
>7dz8K (length=86) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
GFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVI
SNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL
3D structure
PDB7dz8 Structural basis of LhcbM5-mediated state transitions in green algae.
ChainK
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K N60 T61 L65 N33 T34 L38
BS02 CLA K R50 N79 D80 R23 N52 D53
BS03 CLA K G102 G106 G109 G75 G79 G82
BS04 CLA K N35 M38 V39 H97 N8 M11 V12 H70
BS05 CLA K A44 A48 L53 A54 P55 L65 A17 A21 L26 A27 P28 L38
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dz8, PDBe:7dz8, PDBj:7dz8
PDBsum7dz8
PubMed34239095
UniProtP14225|PSAK_CHLRE Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]