Structure of PDB 7d0j Chain K

Receptor sequence
>7d0jK (length=85) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
FIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVIS
NDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL
3D structure
PDB7d0j Structure of photosystem I-LHCI-LHCII from the green alga Chlamydomonas reinhardtii in State 2.
ChainK
Resolution3.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K N60 T61 N32 T33
BS02 CLA K G102 G106 G109 G74 G78 G81
BS03 CLA K N35 M38 H97 N7 M10 H69
BS04 CLA K R50 S78 N79 R22 S50 N51
BS05 CLA K A44 A48 L53 P55 A16 A20 L25 P27
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d0j, PDBe:7d0j, PDBj:7d0j
PDBsum7d0j
PubMed33597543
UniProtP14225|PSAK_CHLRE Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]