Structure of PDB 7blx Chain K

Receptor sequence
>7blxK (length=84) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
FIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVIS
NDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGA
3D structure
PDB7blx Dimeric and high-resolution structures of Chlamydomonas Photosystem I from a temperature-sensitive Photosystem II mutant
ChainK
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K V87 L90 A91 V59 L62 A63
BS02 CLA K N60 T61 L65 N32 T33 L37
BS03 CLA K A63 L65 A35 L37
BS04 CLA K F29 N35 M38 T42 H97 F1 N7 M10 T14 H69
BS05 CLA K G102 G106 G74 G78
BS06 CLA K A44 A48 L53 A16 A20 L25
BS07 CLA K L46 R50 S78 N79 D80 F84 L18 R22 S50 N51 D52 F56
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7blx, PDBe:7blx, PDBj:7blx
PDBsum7blx
PubMed
UniProtP14225|PSAK_CHLRE Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]