Structure of PDB 7bkc Chain K

Receptor sequence

>7bkcK (length=321) Species: 323259 (Methanospirillum hungatei JF-1)

STLFPKYSKTTDGSKVIMEQRLLQQVNNLILDNDICTGCGICSEVCPEEA
ISVGAVGGVRRGLVDDAASIHVDETKCSYCGVCVIMCPFSALALKVDGEE
RLPILEKEGFPTYDKGTAIDQDKCVRCNICDDVCPRDAIDRDVPLFEGED
KEGLAKGQAVELKIRTVVGQKKLGNVNIIDEDCCTCRWCAINCPTEAITV
NKIFEGEITFHAEKCPGGCSTCVDVCPANAIYLPTPKPAKDMKGQIEAKI
AVNKDFCILCGACVNACPGEDIIYLRRDSVKIKGKETDLFKKIKEKLFTP
RTSKVKEQPSLAGSVELKAVS

3D structure

• PDB: 7bkc Three-megadalton complex of methanogenic electron-bifurcating and CO 2 -fixing enzymes.
• Chain: K
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 1.2.99.5: Transferred entry: 1.2.7.12.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	K	C281 P282 C285 T287 C288 C333 P334	C215 P216 C219 T221 C222 C267 P268
BS02	SF4	K	I274 C292 C323 I324 L325 C326 G327 C329	I208 C226 C257 I258 L259 C260 G261 C263
BS03	SF4	K	C47 P48 I52 C78 S79 Y80 C81 G82 C84	C46 P47 I51 C77 S78 Y79 C80 G81 C83
BS04	SF4	K	C37 T38 C40 C43 C88 L93	C36 T37 C39 C42 C87 L92
BS05	SF4	K	I120 C125 V126 C128 C131 C259 P260 I264	I119 C124 V125 C127 C130 C193 P194 I198
BS06	SF4	K	C135 P136 I140 I244 C249 C250 T251 C252 R253 C255	C134 P135 I139 I178 C183 C184 T185 C186 R187 C189

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity

External links

• PDB: RCSB:7bkc, PDBe:7bkc, PDBj:7bkc
• PDBsum: 7bkc
• PubMed: 34516836
• UniProt: Q2FKZ4