Structure of PDB 7aav Chain K

Receptor sequence
>7aavK (length=123) Species: 9606 (Homo sapiens) [Search protein sequence]
NDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELR
ANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFN
KTILPKVMQVKNFGRSGRTKYTH
3D structure
PDB7aav Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
ChainK
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K Y341 T389 Y391 Y71 T119 Y121
BS02 rna K F383 R385 S386 R388 F113 R115 S116 R118
BS03 KGN K Y341 H343 Y71 H73
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0001527 microfibril
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005813 centrosome
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aav, PDBe:7aav, PDBj:7aav
PDBsum7aav
PubMed33243851
UniProtP55081|MFAP1_HUMAN Microfibrillar-associated protein 1 (Gene Name=MFAP1)

[Back to BioLiP]