Structure of PDB 6ywv Chain K

Receptor sequence

>6ywvK (length=157) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]

GSWLEPNLNRKKKMMKGRPRVPTGGSTKGTTVVWGDYGLRMRDHHRRISA
QQLKLAEDTIKQRLRGQKYRLYKRVACNVGVYVSSFDHWATRVAVNQIIF
EIRGQLHEQVIRDAFRLAGHKLPGLYEFVKKGDPPVVGITKLEDGLTVED
LKNPRKK

3D structure

PDB

6ywv Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.

Chain

Resolution

3.03 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	G61 W63 N67 L68 K73 M75 K76 G77 R78 P82 G84 S86 K88 G89 W94 R107 L115 R130 R134 N138 V143 S144 L188 H191 K192 L196	G1 W3 N7 L8 K13 M15 K16 G17 R18 P22 G24 S26 K28 G29 W34 R47 L55 R70 R74 N78 V83 S84 L117 H120 K121 L125
BS02	MG	K	G190 H191 L193 G195	G119 H120 L122 G124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ywv, PDBe:6ywv, PDBj:6ywv
PDBsum	6ywv
PubMed	33056988
UniProt	F5HIJ5\|RM16_NEUCR Large ribosomal subunit protein uL16m (Gene Name=mrpl16)

[Back to BioLiP]