Structure of PDB 6w6v Chain K

Receptor sequence
>6w6vK (length=79) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KDQAEKYQERSLRQKYNLLHVLPTLNSRALSGLYYKNFHNSVKRYQIMLP
EQLKSGKFCSHCGCVYVPNFNASLQLTTN
3D structure
PDB6w6v Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
ChainK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K H41 K45 H39 K43
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004518 nuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000460 maturation of 5.8S rRNA
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0030541 plasmid partitioning
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6v, PDBe:6w6v, PDBj:6w6v
PDBsum6w6v
PubMed32651392
UniProtP40993|RMRP_YEAST Ribonuclease MRP protein subunit SNM1 (Gene Name=SNM1)

[Back to BioLiP]