Structure of PDB 6w6l Chain K

Receptor sequence
>6w6lK (length=152) Species: 9606 (Homo sapiens) [Search protein sequence]
KNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSS
EALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRPQGTVARVHIGQVI
MSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMV
AE
3D structure
PDB6w6l An ER translocon for multi-pass membrane protein biogenesis.
ChainK
Resolution3.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K E56 Y57 E44 Y45
BS02 rna K K13 N14 K15 Y17 F22 F34 D35 K39 K40 E63 A67 R90 H92 F94 R98 F157 K158 P160 K1 N2 K3 Y5 F10 F22 D23 K27 K28 E51 A55 R78 H80 F82 R86 F122 K123 P125
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043066 negative regulation of apoptotic process
GO:1990403 embryonic brain development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005790 smooth endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0032991 protein-containing complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6l, PDBe:6w6l, PDBj:6w6l
PDBsum6w6l
PubMed32820719
UniProtP27635|RL10_HUMAN Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]