Structure of PDB 6w1o Chain K

Receptor sequence
>6w1oK (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB6w1o Untangling the sequence of events during the S2→ S3transition in photosystem II and implications for the water oxidation mechanism.
ChainK
Resolution2.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide K D23 V24 I28 L35 W39 V43 R46 D14 V15 I19 L26 W30 V34 R37
BS02 CLA K P29 L33 P20 L24
BS03 CLA K F32 W39 Q40 F23 W30 Q31
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6w1o, PDBe:6w1o, PDBj:6w1o
PDBsum6w1o
PubMed32434915
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]