Structure of PDB 6v8s Chain K

Receptor sequence

>6v8sK (length=151) Species: 3818 (Arachis hypogaea) [Search protein sequence]

GVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPG
TVKKVTAVEGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKT
KLEAADGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLS
N

3D structure

PDB

6v8s Crystal structure of Ara h 8.0201

Chain

Resolution

2.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	2AN	K	F100 V117 K136 S139 Q140 F143	F98 V115 K134 S137 Q138 F141
BS02	2AN	K	A58 S65 V67 G90 Q92 K138 I142	A57 S63 V65 G88 Q90 K136 I140
BS03	2AN	K	A37 K138	A36 K136
BS04	2AN	K	E45 V53 L68 S86	E44 V52 L66 S84
BS05	2AN	K	K122 G123 D124 A125 P126	K120 G121 D122 A123 P124
BS06	2AN	K	G148 Y149 S152 N153	G146 Y147 S150 N151

Gene Ontology

	Molecular Function
GO:0004864	protein phosphatase inhibitor activity
GO:0010427	abscisic acid binding
GO:0038023	signaling receptor activity

	Biological Process
GO:0006952	defense response
GO:0009738	abscisic acid-activated signaling pathway

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6v8s, PDBe:6v8s, PDBj:6v8s
PDBsum	6v8s
PubMed
UniProt	B0YIU5

[Back to BioLiP]