Structure of PDB 6tmf Chain K

Receptor sequence

>6tmfK (length=126) Species: 1293037 (Thermococcus celer Vu 13 = JCM 8558) [Search protein sequence]

AIWQGRSLKKPSGGRIILARKKRKRELGREPAFTRVGEEKEKKKIIRTYG
GNRKVRLIEAIYANVFENGKGRKVKVLGVVENPANRQYVRRDIITKGAII
ETEAGRAIVTSRPGQDGVVNAVLIKE

3D structure

PDB

6tmf Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	I3 Q5 G6 R7 S8 K10 K11 P12 S13 R16 I18 A20 R21 K22 K23 R24 K25 R26 G29 R30 P32 A33 K44 K45 R48 T49 Y50 G51 N53 R54 K55 R57 N65 F67 G70 G72 K74 A85 R87 K97 G98 T111 R113 G115 Q116 D117 V119 N121	I2 Q4 G5 R6 S7 K9 K10 P11 S12 R15 I17 A19 R20 K21 K22 R23 K24 R25 G28 R29 P31 A32 K43 K44 R47 T48 Y49 G50 N52 R53 K54 R56 N64 F66 G69 G71 K73 A84 R86 K96 G97 T110 R112 G114 Q115 D116 V118 N120

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links