Structure of PDB 6t90 Chain K

Receptor sequence

DIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRF
EALQLSFKNMCKLRPLLQKWVEE

3D structure

PDB

6t90 Mechanisms of OCT4-SOX2 motif readout on nucleosomes.

Chain

Resolution

3.05 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	K	T163 Q164 C185 R186	T26 Q27 C48 R49
BS02	dna	K	T182 T183 S193 N196	T45 T46 S56 N59

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003674	molecular_function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0031625	ubiquitin protein ligase binding
GO:0035198	miRNA binding
GO:0043565	sequence-specific DNA binding
GO:1990837	sequence-specific double-stranded DNA binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001714	endodermal cell fate specification
GO:0001824	blastocyst development
GO:0006091	generation of precursor metabolites and energy
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0008218	bioluminescence
GO:0009611	response to wounding
GO:0009653	anatomical structure morphogenesis
GO:0009786	regulation of asymmetric cell division
GO:0010468	regulation of gene expression
GO:0035019	somatic stem cell population maintenance
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:1902894	negative regulation of miRNA transcription

External links

PDB	RCSB:6t90, PDBe:6t90, PDBj:6t90
PDBsum	6t90
PubMed	32327602
UniProt	P42212\|GFP_AEQVI Green fluorescent protein (Gene Name=GFP); Q01860\|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)