Structure of PDB 6swe Chain K

Receptor sequence

>6sweK (length=134) Species: 272844 (Pyrococcus abyssi GE5)

RIIQTTGKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTILEPLIL
AGEEIWNSVDIDVKVQGGGFMGQAEAARIAIARALVEWTGDMNLKEKFIK
YDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

3D structure

• PDB: 6swe Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
• Chain: K
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	R10 K11 T12 R16 R20 G69 G70 M72 Q74 R104 R112 R113 T114 E115 H117 K118 P119 R121 S122 K124 G125 P126 R127 K129 R130 Q131 K132 S133	R9 K10 T11 R15 R19 G68 G69 M71 Q73 R103 R111 R112 T113 E114 H116 K117 P118 R120 S121 K123 G124 P125 R126 K128 R129 Q130 K131 S132

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6swe, PDBe:6swe, PDBj:6swe
• PDBsum: 6swe
• PubMed: 32029867
• UniProt: Q9V195|RS9_PYRAB Small ribosomal subunit protein uS9 (Gene Name=rps9)